CHAF1B Antikörper

Produktnummer ABIN634083

Produktdetails anti-CHAF1B Antikörper

Target: CHAF1B (Chromatin Assembly Factor 1, Subunit B (p60) (CHAF1B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHAF1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CHAF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHAF1B Blocking Peptide, catalog no. 33R-4709, is also available for use as a blocking control in assays to test for specificity of this CHAF1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHAF1B

Target: CHAF1B (Chromatin Assembly Factor 1, Subunit B (p60) (CHAF1B))

Andere Bezeichnung: CHAF1B (CHAF1B Produkte)

Synonyme: CHAF1B antikoerper, wu:fd07c09 antikoerper, wu:fe36g06 antikoerper, wu:fv38g09 antikoerper, zgc:56096 antikoerper, CAF-1 antikoerper, CAF-IP60 antikoerper, CAF1 antikoerper, CAF1A antikoerper, CAF1P60 antikoerper, MPHOSPH7 antikoerper, MPP7 antikoerper, 2600017H24Rik antikoerper, C76145 antikoerper, CAF-I p60 antikoerper, CAF-Ip60 antikoerper, caf-1 antikoerper, CAF-1P60 antikoerper, chromatin assembly factor 1 subunit B antikoerper, chromatin assembly factor 1, subunit B antikoerper, chromatin assembly factor 1, subunit B (p60) antikoerper, chromatin assembly factor 1 subunit B L homeolog antikoerper, CHAF1B antikoerper, chaf1b antikoerper, Chaf1b antikoerper, chaf1b.L antikoerper

Hintergrund: Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. CHAF1B corresponds to the p60 subunit and is required for chromatin assembly after replication. CHAF1B is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair.

Molekulargewicht: 61 kDa (MW of target protein)