CDKN3 Antikörper

Produktnummer ABIN634079

Der Kaninchen Polyklonal anti-CDKN3 Antikörper wird verwendet zum Nachweis von CDKN3 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für CDKN3 Antikörper (ABIN634079)

Target: CDKN3 (Cyclin-Dependent Kinase Inhibitor 3 (CDKN3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDKN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CDKN3 Antikörper

Aufreinigung: Affinity purified

Immunogen: CDKN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDKN3 Blocking Peptide, (ABIN937106), is also available for use as a blocking control in assays to test for specificity of this CDKN3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDKN3

Target: CDKN3 (Cyclin-Dependent Kinase Inhibitor 3 (CDKN3))

Andere Bezeichnung: CDKN3

Hintergrund: The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers.

Molekulargewicht: 23 kDa (MW of target protein)