-
- Target Alle NEK3 Antikörper anzeigen
- NEK3 (NIMA related kinase 3 (NEK3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NEK3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NEK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMA
- Top Product
- Discover our top product NEK3 Primärantikörper
-
anti-NIMA related kinase 3 (NEK3) (AA 331-361) antibody
NEK3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB2961 unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 406-506) antibodyNEK3 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 2F8 unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 267-506) antibodyNEK3 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 1-506) antibodyNEK3 Reaktivität: Human WB, IF, IP Wirt: Kaninchen Polyclonal unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 1-506) antibodyNEK3 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 446-474), (C-Term) antibodyNEK3 Reaktivität: Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB34647 unconjugated
anti-NIMA related kinase 3 (NEK3) (AA 108-157) antibodyNEK3 Reaktivität: Human, Rind (Kuh), Meerschweinchen, Pferd, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-NIMA related kinase 3 (NEK3) antibodyNEK3 Reaktivität: Human WB, IF, IC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NEK3 Blocking Peptide, catalog no. 33R-3099, is also available for use as a blocking control in assays to test for specificity of this NEK3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NEK3 (NIMA related kinase 3 (NEK3))
- Andere Bezeichnung
- NEK3 (NEK3 Produkte)
- Synonyme
- HSPK36 antikoerper, ATNEK3 antikoerper, NIMA-RELATED KINASE3 antikoerper, NIMA-related kinase 3 antikoerper, T8M17.60 antikoerper, T8M17_60 antikoerper, NIMA related kinase 3 antikoerper, NIMA (never in mitosis gene a)-related expressed kinase 3 antikoerper, NIMA-related kinase 3 S homeolog antikoerper, NIMA-related kinase 3 antikoerper, NEK3 antikoerper, Nek3 antikoerper, nek3.S antikoerper
- Hintergrund
- NEK3 is a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. It differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase.
- Molekulargewicht
- 58 kDa (MW of target protein)
-
Sie sind hier:
