NEK3 Antikörper

Produktnummer ABIN634077

Der Kaninchen Polyklonal anti-NEK3 Antikörper (ABIN634077) detektiert spezifisch NEK3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für NEK3 Antikörper (ABIN634077)

Target: NEK3 (NIMA related kinase 3 (NEK3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NEK3 Antikörper

Aufreinigung: Affinity purified

Immunogen: NEK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NEK3 Blocking Peptide, (ABIN938485), is also available for use as a blocking control in assays to test for specificity of this NEK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NEK3

Target: NEK3 (NIMA related kinase 3 (NEK3))

Andere Bezeichnung: NEK3

Hintergrund: NEK3 is a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. It differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase.

Molekulargewicht: 58 kDa (MW of target protein)