NEK3 Antikörper
-
- Target Alle NEK3 Antikörper anzeigen
- NEK3 (NIMA related kinase 3 (NEK3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NEK3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NEK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMA
- Top Product
- Discover our top product NEK3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NEK3 Blocking Peptide, catalog no. 33R-3099, is also available for use as a blocking control in assays to test for specificity of this NEK3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEK3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NEK3 (NIMA related kinase 3 (NEK3))
- Andere Bezeichnung
- NEK3 (NEK3 Produkte)
- Hintergrund
- NEK3 is a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. It differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase.
- Molekulargewicht
- 58 kDa (MW of target protein)
-