GTSE1 Antikörper (N-Term)

Produktnummer ABIN634069

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GTSE1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für GTSE1 Antikörper (N-Term) (ABIN634069)

Target: GTSE1 (G-2 and S-Phase Expressed 1 (GTSE1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GTSE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GTSE1 Antikörper

Bindungsspezifität: N-Term

Spezifität: GTSE1 antibody was raised against the N terminal of GTSE1

Aufreinigung: Affinity purified

Immunogen: GTSE1 antibody was raised using the N terminal of GTSE1 corresponding to a region with amino acids NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GTSE1 Blocking Peptide, (ABIN5613908), is also available for use as a blocking control in assays to test for specificity of this GTSE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTSE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GTSE1

Target: GTSE1 (G-2 and S-Phase Expressed 1 (GTSE1))

Andere Bezeichnung: GTSE1

Hintergrund: GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.

Molekulargewicht: 76 kDa (MW of target protein)