RDH16 Antikörper

Produktnummer ABIN634066

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch RDH16 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für RDH16 Antikörper (ABIN634066)

Target: RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RDH16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RDH16 Antikörper

Aufreinigung: Affinity purified

Immunogen: RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RDH16 Blocking Peptide, (ABIN5615820), is also available for use as a blocking control in assays to test for specificity of this RDH16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RDH16

Target: RDH16 (Retinol Dehydrogenase 16 (All-Trans) (RDH16))

Andere Bezeichnung: RDH16

Hintergrund: RDH16 is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis