SEMG1 Antikörper (Middle Region)

Produktnummer ABIN634064

Der Kaninchen Polyklonal anti-SEMG1 Antikörper wird verwendet zum Nachweis von SEMG1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für SEMG1 Antikörper (Middle Region) (ABIN634064)

Target: SEMG1 (Semenogelin I (SEMG1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEMG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SEMG1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Semenogelin I antibody was raised against the middle region of SEMG1

Aufreinigung: Affinity purified

Immunogen: Semenogelin I antibody was raised using the middle region of SEMG1 corresponding to a region with amino acids KDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Semenogelin I Blocking Peptide, (ABIN939675), is also available for use as a blocking control in assays to test for specificity of this Semenogelin I antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEMG1

Target: SEMG1 (Semenogelin I (SEMG1))

Andere Bezeichnung: Semenogelin I

Hintergrund: SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes this protein into smaller peptides.

Molekulargewicht: 40 kDa (MW of target protein)