POFUT2 Antikörper (N-Term)

Produktnummer ABIN634059

Dieses Anti-POFUT2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von POFUT2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für POFUT2 Antikörper (N-Term) (ABIN634059)

Target: POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POFUT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-POFUT2 Antikörper

Bindungsspezifität: N-Term

Spezifität: POFUT2 antibody was raised against the N terminal of POFUT2

Aufreinigung: Affinity purified

Immunogen: POFUT2 antibody was raised using the N terminal of POFUT2 corresponding to a region with amino acids GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POFUT2 Blocking Peptide, (ABIN938535), is also available for use as a blocking control in assays to test for specificity of this POFUT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POFUT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POFUT2

Target: POFUT2 (Protein O-Fucosyltransferase 2 (POFUT2))

Andere Bezeichnung: POFUT2

Hintergrund: POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats. Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor-like repeats or thrombospondin.

Molekulargewicht: 50 kDa (MW of target protein)