LCN12 Antikörper (N-Term)

Produktnummer ABIN634058

Der Kaninchen Polyklonal Anti-LCN12-Antikörper wurde für WB validiert. Er ist geeignet, LCN12 in Proben von Human zu detektieren.

Kurzübersicht für LCN12 Antikörper (N-Term) (ABIN634058)

Target: LCN12 (Lipocalin 12 (LCN12))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCN12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LCN12 Antikörper

Bindungsspezifität: N-Term

Spezifität: Lipocalin 12 antibody was raised against the N terminal of LCN12

Aufreinigung: Affinity purified

Immunogen: Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lipocalin 12 Blocking Peptide, (ABIN938840), is also available for use as a blocking control in assays to test for specificity of this Lipocalin 12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCN12

Target: LCN12 (Lipocalin 12 (LCN12))

Andere Bezeichnung: Lipocalin 12

Hintergrund: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.

Molekulargewicht: 39 kDa (MW of target protein)