ASAH1 Antikörper

Produktnummer ABIN634056

Der Kaninchen Polyklonal anti-ASAH1 Antikörper (ABIN634056) detektiert spezifisch ASAH1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für ASAH1 Antikörper (ABIN634056)

Target: ASAH1 (N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASAH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ASAH1 Antikörper

Aufreinigung: Affinity purified

Immunogen: ASAH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASAH1 Blocking Peptide, (ABIN5612175), is also available for use as a blocking control in assays to test for specificity of this ASAH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASAH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASAH1

Target: ASAH1 (N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1))

Andere Bezeichnung: ASAH1

Hintergrund: This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally.

Molekulargewicht: 14 kDa (MW of target protein)