KLHDC4 Antikörper (N-Term)

Produktnummer ABIN634055

Der Kaninchen Polyklonal Anti-KLHDC4-Antikörper wurde für WB validiert. Er ist geeignet, KLHDC4 in Proben von Human und Maus zu detektieren.

Kurzübersicht für KLHDC4 Antikörper (N-Term) (ABIN634055)

Target: KLHDC4 (Kelch Domain Containing 4 (KLHDC4))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHDC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KLHDC4 Antikörper

Bindungsspezifität: N-Term

Spezifität: KLHDC4 antibody was raised against the N terminal of KLHDC4

Aufreinigung: Affinity purified

Immunogen: KLHDC4 antibody was raised using the N terminal of KLHDC4 corresponding to a region with amino acids MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHDC4 Blocking Peptide, (ABIN5614371), is also available for use as a blocking control in assays to test for specificity of this KLHDC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHDC4

Target: KLHDC4 (Kelch Domain Containing 4 (KLHDC4))

Andere Bezeichnung: KLHDC4

Hintergrund: KLHDC4 is involved in protein binding.

Molekulargewicht: 58 kDa (MW of target protein)