VPS29 Antikörper

Produktnummer ABIN634054

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch VPS29 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für VPS29 Antikörper (ABIN634054)

Target: VPS29 (Vacuolar Protein Sorting 29 (VPS29))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VPS29 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VPS29 Antikörper

Aufreinigung: Affinity purified

Immunogen: VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VPS29 Blocking Peptide, (ABIN940220), is also available for use as a blocking control in assays to test for specificity of this VPS29 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS29 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VPS29

Target: VPS29 (Vacuolar Protein Sorting 29 (VPS29))

Andere Bezeichnung: VPS29

Hintergrund: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex.

Molekulargewicht: 20 kDa (MW of target protein)