PCOLCE Antikörper (Middle Region)

Produktnummer ABIN634051

Produktdetails anti-PCOLCE Antikörper

Target: PCOLCE (Procollagen C-Endopeptidase Enhancer (PCOLCE))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCOLCE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PCOLCE antibody was raised against the middle region of PCOLCE

Aufreinigung: Affinity purified

Immunogen: PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCOLCE Blocking Peptide, catalog no. 33R-5197, is also available for use as a blocking control in assays to test for specificity of this PCOLCE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCOLCE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCOLCE

Target: PCOLCE (Procollagen C-Endopeptidase Enhancer (PCOLCE))

Andere Bezeichnung: PCOLCE (PCOLCE Produkte)

Synonyme: PCPE antikoerper, PCPE-1 antikoerper, PCPE1 antikoerper, Astt-2 antikoerper, Astt2 antikoerper, P14 antikoerper, procollagen C-endopeptidase enhancer antikoerper, procollagen C-endopeptidase enhancer L homeolog antikoerper, procollagen C-endopeptidase enhancer protein antikoerper, PCOLCE antikoerper, Pcolce antikoerper, pcolce.L antikoerper

Hintergrund: PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Molekulargewicht: 48 kDa (MW of target protein)