CREG2 Antikörper (N-Term)

Produktnummer ABIN634048

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CREG2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für CREG2 Antikörper (N-Term) (ABIN634048)

Target: CREG2 (Cellular Repressor of E1A-Stimulated Genes 2 (CREG2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CREG2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CREG2 Antikörper

Bindungsspezifität: N-Term

Spezifität: CREG2 antibody was raised against the N terminal of CREG2

Aufreinigung: Affinity purified

Immunogen: CREG2 antibody was raised using the N terminal of CREG2 corresponding to a region with amino acids VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CREG2 Blocking Peptide, (ABIN5612997), is also available for use as a blocking control in assays to test for specificity of this CREG2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREG2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CREG2

Target: CREG2 (Cellular Repressor of E1A-Stimulated Genes 2 (CREG2))

Andere Bezeichnung: CREG2

Hintergrund: The function of CREG2 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 32 kDa (MW of target protein)