PRSS35 Antikörper (N-Term)

Produktnummer ABIN634047

Dieses Anti-PRSS35-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PRSS35 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für PRSS35 Antikörper (N-Term) (ABIN634047)

Target: PRSS35 (Protease, serine, 35 (PRSS35))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRSS35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PRSS35 Antikörper

Bindungsspezifität: N-Term

Spezifität: PRSS35 antibody was raised against the N terminal of PRSS35

Aufreinigung: Affinity purified

Immunogen: PRSS35 antibody was raised using the N terminal of PRSS35 corresponding to a region with amino acids PTQNITTKGVSVRRKRQVYGTDSRFSILDKRFLTNFPFSTAVKLSTGCSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRSS35 Blocking Peptide, (ABIN5615604), is also available for use as a blocking control in assays to test for specificity of this PRSS35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRSS35

Target: PRSS35 (Protease, serine, 35 (PRSS35))

Andere Bezeichnung: PRSS35

Hintergrund: The function of PRSS35 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 47 kDa (MW of target protein)