BMPER Antikörper (C-Term)

Produktnummer ABIN634046

Der Kaninchen Polyklonal Anti-BMPER-Antikörper wurde für WB validiert. Er ist geeignet, BMPER in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für BMPER Antikörper (C-Term) (ABIN634046)

Target: BMPER (BMP Binding Endothelial Regulator (BMPER))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BMPER Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BMPER Antikörper

Bindungsspezifität: C-Term

Spezifität: BMPER antibody was raised against the C terminal of BMPER

Aufreinigung: Affinity purified

Immunogen: BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BMPER Blocking Peptide, (ABIN5612349), is also available for use as a blocking control in assays to test for specificity of this BMPER antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BMPER antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BMPER

Target: BMPER (BMP Binding Endothelial Regulator (BMPER))

Andere Bezeichnung: BMPER

Hintergrund: BMPER contains 1 TIL (trypsin inhibitory-like) domain, 5 VWFC domains and 1 VWFD domain.BMPER is the inhibitor of bone morphogenetic protein (BMP) functions. It may regulate BMP responsiveness of osteoblasts and chondrocytes.

Molekulargewicht: 76 kDa (MW of target protein)