CHAD Antikörper (Middle Region)

Produktnummer ABIN634044

Produktdetails anti-CHAD Antikörper

Target: CHAD (Chondroadherin (CHAD))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHAD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Chondroadherin antibody was raised against the middle region of CHAD

Aufreinigung: Affinity purified

Immunogen: Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids VDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Chondroadherin Blocking Peptide, catalog no. 33R-9477, is also available for use as a blocking control in assays to test for specificity of this Chondroadherin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHAD

Target: CHAD (Chondroadherin (CHAD))

Andere Bezeichnung: Chondroadherin (CHAD Produkte)

Synonyme: CHAD antikoerper, zgc:63475 antikoerper, SLRR4A antikoerper, chondroadherin antikoerper, CHAD antikoerper, chad antikoerper, Chad antikoerper

Hintergrund: Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. CHAD contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages.

Molekulargewicht: 38 kDa (MW of target protein)