CES5A Antikörper (N-Term)

Produktnummer ABIN634041

Dieses Anti-CES5A-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CES5A in WB. Geeignet für Human.

Kurzübersicht für CES5A Antikörper (N-Term) (ABIN634041)

Target: CES5A (Carboxylesterase 5A (CES5A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CES5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CES5A Antikörper

Bindungsspezifität: N-Term

Spezifität: Carboxylesterase 7 antibody was raised against the N terminal of CES7

Aufreinigung: Affinity purified

Immunogen: Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxylesterase 7 Blocking Peptide, (ABIN5612613), is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CES5A

Target: CES5A (Carboxylesterase 5A (CES5A))

Andere Bezeichnung: Carboxylesterase 7

Hintergrund: CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.

Molekulargewicht: 58 kDa (MW of target protein)