CPQ Antikörper (N-Term)

Produktnummer ABIN634040

Der Kaninchen Polyklonal Anti-CPQ-Antikörper wurde für WB validiert. Er ist geeignet, CPQ in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für CPQ Antikörper (N-Term) (ABIN634040)

Target: CPQ (Carboxypeptidase Q (CPQ))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CPQ Antikörper

Bindungsspezifität: N-Term

Spezifität: PGCP antibody was raised against the N terminal of PGCP

Aufreinigung: Affinity purified

Immunogen: PGCP antibody was raised using the N terminal of PGCP corresponding to a region with amino acids VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGCP Blocking Peptide, (ABIN5615332), is also available for use as a blocking control in assays to test for specificity of this PGCP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGCP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPQ

Target: CPQ (Carboxypeptidase Q (CPQ))

Andere Bezeichnung: PGCP

Hintergrund: PGCP is a carboxypeptidase that may play an important role in the hydrolysis of circulating peptides.

Molekulargewicht: 52 kDa (MW of target protein)