TOR3A Antikörper (Middle Region)

Produktnummer ABIN634037

Produktdetails anti-TOR3A Antikörper

Target: TOR3A (Torsin Family 3, Member A (TOR3A))

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TOR3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TOR3 A antibody was raised against the middle region of TOR3

Aufreinigung: Affinity purified

Immunogen: TOR3 A antibody was raised using the middle region of TOR3 corresponding to a region with amino acids FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGP

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TOR3A Blocking Peptide, catalog no. 33R-2919, is also available for use as a blocking control in assays to test for specificity of this TOR3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TOR3A

Target: TOR3A (Torsin Family 3, Member A (TOR3A))

Andere Bezeichnung: TOR3A (TOR3A Produkte)

Synonyme: TOR3A antikoerper, MGC107954 antikoerper, si:ch211-198n5.8 antikoerper, ADIR antikoerper, ADIR2 antikoerper, Adir antikoerper, torsin family 3 member A antikoerper, torsin family 3, member A antikoerper, TOR3A antikoerper, tor3a antikoerper, Tor3a antikoerper

Hintergrund: The function of TOR3A protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 46 kDa (MW of target protein)