TOR3A Antikörper (Middle Region)

Produktnummer ABIN634037

Der Kaninchen-Polyklonal Anti-TOR3A-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von TOR3A in Proben aus Human und Hund. }

Kurzübersicht für TOR3A Antikörper (Middle Region) (ABIN634037)

Target: TOR3A (Torsin Family 3, Member A (TOR3A))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TOR3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TOR3A Antikörper

Bindungsspezifität: Middle Region

Spezifität: TOR3 A antibody was raised against the middle region of TOR3

Aufreinigung: Affinity purified

Immunogen: TOR3 A antibody was raised using the middle region of TOR3 corresponding to a region with amino acids FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGP

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TOR3A Blocking Peptide, (ABIN938305), is also available for use as a blocking control in assays to test for specificity of this TOR3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TOR3A

Target: TOR3A (Torsin Family 3, Member A (TOR3A))

Andere Bezeichnung: TOR3A

Hintergrund: The function of TOR3A protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 46 kDa (MW of target protein)