PAPPA2 Antikörper (N-Term)

Produktnummer ABIN634034

Produktdetails anti-PAPPA2 Antikörper

Target: PAPPA2 (Pappalysin 2 (PAPPA2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAPPA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PAPPA2 antibody was raised against the N terminal of PAPPA2

Aufreinigung: Affinity purified

Immunogen: PAPPA2 antibody was raised using the N terminal of PAPPA2 corresponding to a region with amino acids PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAPPA2 Blocking Peptide, catalog no. 33R-7246, is also available for use as a blocking control in assays to test for specificity of this PAPPA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPPA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAPPA2

Target: PAPPA2 (Pappalysin 2 (PAPPA2))

Andere Bezeichnung: PAPPA2 (PAPPA2 Produkte)

Synonyme: PAPP-A2 antikoerper, PLAC3 antikoerper, Pappe antikoerper, PAPP-E antikoerper, PAPPE antikoerper, si:dkey-39f8.1 antikoerper, pappalysin 2 antikoerper, Pappa2 antikoerper, PAPPA2 antikoerper, pappa2 antikoerper

Hintergrund: PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.

Molekulargewicht: 92 kDa (MW of target protein)