Haptoglobin Antikörper (N-Term)

Produktnummer ABIN634032

Dieses Anti-Haptoglobin-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Haptoglobin in WB. Geeignet für Human.

Kurzübersicht für Haptoglobin Antikörper (N-Term) (ABIN634032)

Target: Haptoglobin (HP)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Haptoglobin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Haptoglobin Antikörper

Bindungsspezifität: N-Term

Spezifität: Haptoglobin antibody was raised against the N terminal of HP

Aufreinigung: Affinity purified

Immunogen: Haptoglobin antibody was raised using the N terminal of HP corresponding to a region with amino acids MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Haptoglobin Blocking Peptide, (ABIN5613925), is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Haptoglobin

Target: Haptoglobin (HP)

Andere Bezeichnung: Haptoglobin

Hintergrund: Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis