LYPD4 Antikörper (N-Term)

Produktnummer ABIN634028

Der Kaninchen Polyklonal Anti-LYPD4-Antikörper wurde für WB validiert. Er ist geeignet, LYPD4 in Proben von Human zu detektieren.

Kurzübersicht für LYPD4 Antikörper (N-Term) (ABIN634028)

Target: LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYPD4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LYPD4 Antikörper

Bindungsspezifität: N-Term

Spezifität: LYPD4 antibody was raised against the N terminal of LYPD4

Aufreinigung: Affinity purified

Immunogen: LYPD4 antibody was raised using the N terminal of LYPD4 corresponding to a region with amino acids MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYPD4 Blocking Peptide, (ABIN5614611), is also available for use as a blocking control in assays to test for specificity of this LYPD4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYPD4

Target: LYPD4 (LY6/PLAUR Domain Containing 4 (LYPD4))

Andere Bezeichnung: LYPD4

Hintergrund: The specific function of LYPD4 is not yet known.

Molekulargewicht: 27 kDa (MW of target protein)