OLFML1 Antikörper (N-Term)

Produktnummer ABIN634027

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch OLFML1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für OLFML1 Antikörper (N-Term) (ABIN634027)

Target: OLFML1 (Olfactomedin-Like 1 (OLFML1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OLFML1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OLFML1 Antikörper

Bindungsspezifität: N-Term

Spezifität: OLFML1 antibody was raised against the N terminal of OLFML1

Aufreinigung: Affinity purified

Immunogen: OLFML1 antibody was raised using the N terminal of OLFML1 corresponding to a region with amino acids IYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OLFML1 Blocking Peptide, (ABIN939610), is also available for use as a blocking control in assays to test for specificity of this OLFML1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OLFML1

Target: OLFML1 (Olfactomedin-Like 1 (OLFML1))

Andere Bezeichnung: OLFML1

Hintergrund: The function of OLFML1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 46 kDa (MW of target protein)