MFAP2 Antikörper (N-Term)

Produktnummer ABIN634025

Produktdetails anti-MFAP2 Antikörper

Target: MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MFAP2 antibody was raised against the N terminal of MFAP2

Aufreinigung: Affinity purified

Immunogen: MFAP2 antibody was raised using the N terminal of MFAP2 corresponding to a region with amino acids MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MFAP2 Blocking Peptide, catalog no. 33R-6351, is also available for use as a blocking control in assays to test for specificity of this MFAP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFAP2

Target: MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))

Andere Bezeichnung: MFAP2 (MFAP2 Produkte)

Synonyme: MAGP antikoerper, MAGP-1 antikoerper, MAGP1 antikoerper, AI893631 antikoerper, Magp antikoerper, Magp1 antikoerper, microfibril associated protein 2 antikoerper, microfibrillar-associated protein 2 antikoerper, MFAP2 antikoerper, Mfap2 antikoerper

Hintergrund: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases.

Molekulargewicht: 19 kDa (MW of target protein)