MFAP2 Antikörper (N-Term)

Produktnummer ABIN634025

Der Kaninchen Polyklonal Anti-MFAP2-Antikörper wurde für WB validiert. Er ist geeignet, MFAP2 in Proben von Human, Ratte und Maus zu detektieren.

Kurzübersicht für MFAP2 Antikörper (N-Term) (ABIN634025)

Target: MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFAP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MFAP2 Antikörper

Bindungsspezifität: N-Term

Spezifität: MFAP2 antibody was raised against the N terminal of MFAP2

Aufreinigung: Affinity purified

Immunogen: MFAP2 antibody was raised using the N terminal of MFAP2 corresponding to a region with amino acids MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MFAP2 Blocking Peptide, (ABIN5614735), is also available for use as a blocking control in assays to test for specificity of this MFAP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFAP2

Target: MFAP2 (Microfibrillar Associated Protein 2 (MFAP2))

Andere Bezeichnung: MFAP2

Hintergrund: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases.

Molekulargewicht: 19 kDa (MW of target protein)