CETP Antikörper (N-Term)

Produktnummer ABIN634021

Produktdetails anti-CETP Antikörper

Target: CETP (Cholesteryl Ester Transfer Protein (CETP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CETP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CETP antibody was raised against the N terminal of CETP

Aufreinigung: Affinity purified

Immunogen: CETP antibody was raised using the N terminal of CETP corresponding to a region with amino acids ALLVLNHETAKVIQTAFQRASYPDITGEKAMMLLGQVKYGLHNIQISHLS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CETP Blocking Peptide, catalog no. 33R-1358, is also available for use as a blocking control in assays to test for specificity of this CETP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CETP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CETP

Target: CETP (Cholesteryl Ester Transfer Protein (CETP))

Andere Bezeichnung: CETP (CETP Produkte)

Synonyme: BPIFF antikoerper, HDLCQ10 antikoerper, hdlcq10 antikoerper, cholesteryl ester transfer protein antikoerper, cholesteryl ester transfer protein L homeolog antikoerper, CETP antikoerper, cetp.L antikoerper, Cetp antikoerper

Hintergrund: CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia.

Molekulargewicht: 53 kDa (MW of target protein)