CPB1 Antikörper

Produktnummer ABIN634020

Der Kaninchen Polyklonal anti-CPB1 Antikörper (ABIN634020) detektiert spezifisch CPB1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für CPB1 Antikörper (ABIN634020)

Target: CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CPB1 Antikörper

Aufreinigung: Affinity purified

Immunogen: Carboxypeptidase B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVIGTTFEGRAIYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxypeptidase B1 Blocking Peptide, (ABIN5612616), is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPB1

Target: CPB1 (Carboxypeptidase B1 (Tissue) (CPB1))

Andere Bezeichnung: Carboxypeptidase B1

Hintergrund: Three different procarboxypeptidases A and two different procarboxypeptidases B have been isolated. The B1 and B2 forms differ from each other mainly in isoelectric point. Carboxypeptidase B1 is a highly tissue-specific protein and is a useful serum marker for acute pancreatitis and dysfunction of pancreatic transplants. It is not elevated in pancreatic carcinoma.

Molekulargewicht: 35 kDa (MW of target protein)