EPX Antikörper (Middle Region)

Produktnummer ABIN634017

Produktdetails anti-EPX Antikörper

Target: EPX (Eosinophil Peroxidase (EPX))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EPX antibody was raised against the middle region of EPX

Aufreinigung: Affinity purified

Immunogen: EPX antibody was raised using the middle region of EPX corresponding to a region with amino acids LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPX Blocking Peptide, catalog no. 33R-4765, is also available for use as a blocking control in assays to test for specificity of this EPX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPX antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPX

Target: EPX (Eosinophil Peroxidase (EPX))

Andere Bezeichnung: EPX (EPX Produkte)

Synonyme: EPX antikoerper, pmr-1 antikoerper, EPO antikoerper, EPP antikoerper, EPX-PEN antikoerper, eosinophil peroxidase antikoerper, eosinophil peroxidase L homeolog antikoerper, LOC788751 antikoerper, EPX antikoerper, epx.L antikoerper, Epx antikoerper

Hintergrund: EPX belongs to the peroxidase family, XPO subfamily. Defects in EPX are the cause of eosinophil peroxidase deficiency (EPD).

Molekulargewicht: 53 kDa (MW of target protein)