ZG16 Antikörper (Middle Region)

Produktnummer ABIN634014

Dieses Anti-ZG16-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ZG16 in WB. Geeignet für Human.

Kurzübersicht für ZG16 Antikörper (Middle Region) (ABIN634014)

Target: ZG16 (Zymogen Granule Protein 16 (ZG16))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZG16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZG16 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ZG16 antibody was raised against the middle region of ZG16

Aufreinigung: Affinity purified

Immunogen: ZG16 antibody was raised using the middle region of ZG16 corresponding to a region with amino acids WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZG16 Blocking Peptide, (ABIN935961), is also available for use as a blocking control in assays to test for specificity of this ZG16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZG16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZG16

Target: ZG16 (Zymogen Granule Protein 16 (ZG16))

Andere Bezeichnung: ZG16

Hintergrund: ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.

Molekulargewicht: 18 kDa (MW of target protein)