PLOD2 Antikörper (Middle Region)
-
- Target Alle PLOD2 Antikörper anzeigen
- PLOD2 (Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 (PLOD2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLOD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PLOD2 antibody was raised against the middle region of PLOD2
- Aufreinigung
- Affinity purified
- Immunogen
- PLOD2 antibody was raised using the middle region of PLOD2 corresponding to a region with amino acids IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM
- Top Product
- Discover our top product PLOD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLOD2 Blocking Peptide, catalog no. 33R-4019, is also available for use as a blocking control in assays to test for specificity of this PLOD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLOD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLOD2 (Procollagen-Lysine 2-Oxoglutarate 5-Dioxygenase 2 (PLOD2))
- Andere Bezeichnung
- PLOD2 (PLOD2 Produkte)
- Synonyme
- D530025C14Rik antikoerper, LH2 antikoerper, Plod-2 antikoerper, TLH antikoerper, procollagen lysine, 2-oxoglutarate 5-dioxygenase 2 antikoerper, procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 antikoerper, Plod2 antikoerper, PLOD2 antikoerper
- Hintergrund
- PLOD2 forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.
- Molekulargewicht
- 84 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-