Chymotrypsin Antikörper (N-Term)

Produktnummer ABIN634009

Produktdetails anti-Chymotrypsin Antikörper

Target: Chymotrypsin (CTRL)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Chymotrypsin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Chymotrypsin-Like antibody was raised against the N terminal of CTRL

Aufreinigung: Affinity purified

Immunogen: Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Chymotrypsin-Like Blocking Peptide, catalog no. 33R-8727, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsin-Like antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Chymotrypsin

Target: Chymotrypsin (CTRL)

Andere Bezeichnung: Chymotrypsin-Like (CTRL Produkte)

Synonyme: 0910001G08Rik antikoerper, 1810004D15Rik antikoerper, AV005227 antikoerper, Ctra-1 antikoerper, Ctra1 antikoerper, chymopasin antikoerper, mFLJ00366 antikoerper, CTRL1 antikoerper, chymotrypsin-like antikoerper, chymotrypsin like antikoerper, Ctrl antikoerper, CTRL antikoerper

Substanzklasse: Chemical

Hintergrund: CTRL possesses serine-type endopeptidase activity.

Molekulargewicht: 28 kDa (MW of target protein)