FUCA1 Antikörper (Middle Region)

Produktnummer ABIN634001

Der Kaninchen Polyklonal Anti-FUCA1-Antikörper wurde für WB validiert. Er ist geeignet, FUCA1 in Proben von Human, Maus und Hund zu detektieren.

Kurzübersicht für FUCA1 Antikörper (Middle Region) (ABIN634001)

Target: FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FUCA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FUCA1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: FUCA1 antibody was raised against the middle region of FUCA1

Aufreinigung: Affinity purified

Immunogen: FUCA1 antibody was raised using the middle region of FUCA1 corresponding to a region with amino acids TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FUCA1 Blocking Peptide, (ABIN5613658), is also available for use as a blocking control in assays to test for specificity of this FUCA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUCA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FUCA1

Target: FUCA1 (Fucosidase, alpha-L- 1, Tissue (FUCA1))

Andere Bezeichnung: FUCA1

Hintergrund: Alpha-L-fucosidase (EC 3.2.1.51) is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. At least 2 separate polymorphic alpha-L-fucosidases are recognised in man.

Molekulargewicht: 54 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process