FETUB Antikörper (N-Term)

Produktnummer ABIN633997

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FETUB in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für FETUB Antikörper (N-Term) (ABIN633997)

Target: FETUB (Fetuin B (FETUB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FETUB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FETUB Antikörper

Bindungsspezifität: N-Term

Spezifität: FETUB antibody was raised against the N terminal of FETUB

Aufreinigung: Affinity purified

Immunogen: FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FETUB Blocking Peptide, (ABIN938575), is also available for use as a blocking control in assays to test for specificity of this FETUB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FETUB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FETUB

Target: FETUB (Fetuin B (FETUB))

Andere Bezeichnung: FETUB

Hintergrund: The protein encoded by this gene is a member of the fetuin family, part of the cystatin superfamily of cysteine protease inhibitors. Fetuins have been implicated in several diverse functions, including osteogenesis and bone resorption.

Molekulargewicht: 42 kDa (MW of target protein)