LYPD6 Antikörper (Middle Region)

Produktnummer ABIN633991

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch LYPD6 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für LYPD6 Antikörper (Middle Region) (ABIN633991)

Target: LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LYPD6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LYPD6 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LYPD6 antibody was raised against the middle region of LYPD6

Aufreinigung: Affinity purified

Immunogen: LYPD6 antibody was raised using the middle region of LYPD6 corresponding to a region with amino acids RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYPD6 Blocking Peptide, (ABIN5614612), is also available for use as a blocking control in assays to test for specificity of this LYPD6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LYPD6

Target: LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))

Andere Bezeichnung: LYPD6

Hintergrund: LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.

Molekulargewicht: 19 kDa (MW of target protein)