SFTPB Antikörper (Middle Region)
-
- Target Alle SFTPB Antikörper anzeigen
- SFTPB (Surfactant Protein B (SFTPB))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SFTPB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SFTPB antibody was raised against the middle region of SFTPB
- Aufreinigung
- Affinity purified
- Immunogen
- SFTPB antibody was raised using the middle region of SFTPB corresponding to a region with amino acids PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV
- Top Product
- Discover our top product SFTPB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFTPB Blocking Peptide, catalog no. 33R-7093, is also available for use as a blocking control in assays to test for specificity of this SFTPB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFTPB (Surfactant Protein B (SFTPB))
- Andere Bezeichnung
- SFTPB (SFTPB Produkte)
- Synonyme
- PSP-B antikoerper, SFTB3 antikoerper, SFTP3 antikoerper, SMDP1 antikoerper, SP-B antikoerper, AI562151 antikoerper, SF-B antikoerper, Sftp-3 antikoerper, Sftp3 antikoerper, Sp-b antikoerper, SFTPB antikoerper, sftpb antikoerper, xSP-B antikoerper, surfactant protein B antikoerper, surfactant associated protein B antikoerper, surfactant, pulmonary-associated protein B L homeolog antikoerper, SFTPB antikoerper, Sftpb antikoerper, sftpb.L antikoerper
- Hintergrund
- SFTPB is the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins.
- Molekulargewicht
- 42 kDa (MW of target protein)
-