SFTPB Antikörper (Middle Region)

Produktnummer ABIN633984

Der Kaninchen Polyklonal anti-SFTPB Antikörper (ABIN633984) detektiert spezifisch SFTPB in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Ratte.

Kurzübersicht für SFTPB Antikörper (Middle Region) (ABIN633984)

Target: SFTPB (Surfactant Protein B (SFTPB))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFTPB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SFTPB Antikörper

Bindungsspezifität: Middle Region

Spezifität: SFTPB antibody was raised against the middle region of SFTPB

Aufreinigung: Affinity purified

Immunogen: SFTPB antibody was raised using the middle region of SFTPB corresponding to a region with amino acids PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFTPB Blocking Peptide, (ABIN5616108), is also available for use as a blocking control in assays to test for specificity of this SFTPB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFTPB

Target: SFTPB (Surfactant Protein B (SFTPB))

Andere Bezeichnung: SFTPB

Hintergrund: SFTPB is the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins.

Molekulargewicht: 42 kDa (MW of target protein)