RDH11 Antikörper

Produktnummer ABIN633983

Der Kaninchen-Polyklonal Anti-RDH11-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von RDH11 in Proben aus Human und Ratte. }

Kurzübersicht für RDH11 Antikörper (ABIN633983)

Target: RDH11 (Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RDH11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RDH11 Antikörper

Aufreinigung: Affinity purified

Immunogen: RDH11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RDH11 Blocking Peptide, (ABIN5615819), is also available for use as a blocking control in assays to test for specificity of this RDH11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RDH11

Target: RDH11 (Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11))

Andere Bezeichnung: RDH11

Hintergrund: RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.

Molekulargewicht: 35 kDa (MW of target protein)