ANGPTL5 Antikörper (N-Term)

Produktnummer ABIN633977

Produktdetails anti-ANGPTL5 Antikörper

Target: ANGPTL5 (Angiopoietin-Like 5 (ANGPTL5))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANGPTL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ANGPTL5 antibody was raised against the N terminal of ANGPTL5

Aufreinigung: Affinity purified

Immunogen: ANGPTL5 antibody was raised using the N terminal of ANGPTL5 corresponding to a region with amino acids ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANGPTL5 Blocking Peptide, catalog no. 33R-1512, is also available for use as a blocking control in assays to test for specificity of this ANGPTL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPTL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANGPTL5

Target: ANGPTL5 (Angiopoietin-Like 5 (ANGPTL5))

Andere Bezeichnung: ANGPTL5 (ANGPTL5 Produkte)

Synonyme: AGF antikoerper, ARP5 antikoerper, ANGPTL5 antikoerper, bZ1P14.8 antikoerper, wu:fe36e01 antikoerper, si:rp71-1p14.8 antikoerper, angiopoietin like 5 antikoerper, angiopoietin like 6 antikoerper, angiopoietin-like 5 antikoerper, ANGPTL5 antikoerper, ANGPTL6 antikoerper, angptl5 antikoerper, Angptl5 antikoerper

Hintergrund: The function of ANGPTL5 has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 44 kDa (MW of target protein)