PAPPA2 Antikörper (Middle Region)
-
- Target Alle PAPPA2 Antikörper anzeigen
- PAPPA2 (Pappalysin 2 (PAPPA2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAPPA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PAPPA2 antibody was raised against the middle region of PAPPA2
- Aufreinigung
- Affinity purified
- Immunogen
- PAPPA2 antibody was raised using the middle region of PAPPA2 corresponding to a region with amino acids ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVL
- Top Product
- Discover our top product PAPPA2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PAPPA2 Blocking Peptide, catalog no. 33R-1360, is also available for use as a blocking control in assays to test for specificity of this PAPPA2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPPA2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAPPA2 (Pappalysin 2 (PAPPA2))
- Andere Bezeichnung
- PAPPA2 (PAPPA2 Produkte)
- Synonyme
- PAPP-A2 antikoerper, PLAC3 antikoerper, Pappe antikoerper, PAPP-E antikoerper, PAPPE antikoerper, si:dkey-39f8.1 antikoerper, pappalysin 2 antikoerper, Pappa2 antikoerper, PAPPA2 antikoerper, pappa2 antikoerper
- Hintergrund
- PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.
- Molekulargewicht
- 92 kDa (MW of target protein)
-