HMGCL Antikörper

Produktnummer ABIN633970

Produktdetails anti-HMGCL Antikörper

Target: HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HMGCL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HMGCL Blocking Peptide, catalog no. 33R-4801, is also available for use as a blocking control in assays to test for specificity of this HMGCL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HMGCL

Target: HMGCL (3-Hydroxymethyl-3-Methylglutaryl-CoA Lyase (HMGCL))

Andere Bezeichnung: HMGCL (HMGCL Produkte)

Synonyme: Afu7g01720 antikoerper, AO090038000541 antikoerper, AW476067 antikoerper, HL antikoerper, zgc:56248 antikoerper, 3-hydroxymethyl-3-methylglutaryl-CoA lyase S homeolog antikoerper, 3-hydroxymethyl-3-methylglutaryl-CoA lyase antikoerper, 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase antikoerper, 3-hydroxy-3-methylglutaryl-Coenzyme A lyase antikoerper, hmgcl.S antikoerper, HMGCL antikoerper, AFUA_7G01720 antikoerper, NFIA_114450 antikoerper, ACLA_065820 antikoerper, AOR_1_910074 antikoerper, PMAA_004600 antikoerper, TSTA_103060 antikoerper, ARB_04874 antikoerper, TRV_06573 antikoerper, Hmgcl antikoerper, hmgcl antikoerper

Hintergrund: The HMGCL protein belongs to the HMG-CoA lyase family. It is a mitochondrial enzyme that catalyzes the final step of leucine degradation and plays a key role in ketone body formation. Mutations in this gene are associated with HMG-CoA lyase deficiency.

Molekulargewicht: 36 kDa (MW of target protein)