ERLIN2 Antikörper (Middle Region)

Produktnummer ABIN633961

Produktdetails anti-ERLIN2 Antikörper

Target: ERLIN2 (ER Lipid Raft Associated 2 (ERLIN2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERLIN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ERLIN2 antibody was raised against the middle region of ERLIN2

Aufreinigung: Affinity purified

Immunogen: ERLIN2 antibody was raised using the middle region of ERLIN2 corresponding to a region with amino acids ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERLIN2 Blocking Peptide, catalog no. 33R-1518, is also available for use as a blocking control in assays to test for specificity of this ERLIN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERLIN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERLIN2

Target: ERLIN2 (ER Lipid Raft Associated 2 (ERLIN2))

Andere Bezeichnung: ERLIN2 (ERLIN2 Produkte)

Synonyme: C8orf2 antikoerper, Erlin-2 antikoerper, NET32 antikoerper, SPFH2 antikoerper, SPG18 antikoerper, BC036333 antikoerper, C87251 antikoerper, Spfh2 antikoerper, Erlin-2-B antikoerper, erlin1 antikoerper, spfh1 antikoerper, spfh2 antikoerper, spfh2-B antikoerper, RGD1309010 antikoerper, SPFH domain-containing protein 2-A antikoerper, erlin2 antikoerper, erlin2-a antikoerper, erlin2-b antikoerper, spfh2-A antikoerper, ER lipid raft associated 2 antikoerper, erlin-2 antikoerper, Erlin-2 antikoerper, ER lipid raft associated 2 S homeolog antikoerper, ER lipid raft associated 2 L homeolog antikoerper, ERLIN2 antikoerper, erlin2 antikoerper, Tsp_03442 antikoerper, erln2 antikoerper, Erlin2 antikoerper, erlin2.S antikoerper, erlin2.L antikoerper

Hintergrund: ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.

Molekulargewicht: 38 kDa (MW of target protein)