ERLIN2 Antikörper (Middle Region)

Produktnummer ABIN633961

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch ERLIN2 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für ERLIN2 Antikörper (Middle Region) (ABIN633961)

Target: ERLIN2 (ER Lipid Raft Associated 2 (ERLIN2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ERLIN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ERLIN2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ERLIN2 antibody was raised against the middle region of ERLIN2

Aufreinigung: Affinity purified

Immunogen: ERLIN2 antibody was raised using the middle region of ERLIN2 corresponding to a region with amino acids ASNSKIYFGKDIPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ERLIN2 Blocking Peptide, (ABIN936904), is also available for use as a blocking control in assays to test for specificity of this ERLIN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERLIN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ERLIN2

Target: ERLIN2 (ER Lipid Raft Associated 2 (ERLIN2))

Andere Bezeichnung: ERLIN2

Hintergrund: ERLIN2 plays an important role in the early steps of the endoplasmic reticulum-associated degradation (ERAD) pathway. It is involved in ITPR1 degradation by the ERAD pathway.

Molekulargewicht: 38 kDa (MW of target protein)