Plexin A4 Antikörper (Middle Region)

Produktnummer ABIN633960

Produktdetails anti-Plexin A4 Antikörper

Target: Plexin A4 (PLXNA4)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Plexin A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Plexin A4 antibody was raised against the middle region of PLXNA4

Aufreinigung: Affinity purified

Immunogen: Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Plexin A4 Blocking Peptide, catalog no. 33R-9241, is also available for use as a blocking control in assays to test for specificity of this Plexin A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Plexin A4

Target: Plexin A4 (PLXNA4)

Andere Bezeichnung: Plexin A4 (PLXNA4 Produkte)

Synonyme: D204 antikoerper, wu:fd49b01 antikoerper, wu:fe15f03 antikoerper, PLXNA4A antikoerper, FAYV2820 antikoerper, PLEXA4 antikoerper, PLXNA4B antikoerper, PRO34003 antikoerper, 9330117B14 antikoerper, Plxa4 antikoerper, mKIAA1550 antikoerper, PLEX2 antikoerper, Plxna4 antikoerper, PLXNA4 antikoerper, plexin A4 antikoerper, plexin-A4 antikoerper, plxna4 antikoerper, PLXNA4 antikoerper, LOC100467706 antikoerper, Plxna4 antikoerper

Hintergrund: This protein mediates semaphorin receptor activity.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Regulation of Cell Size