FUT6 Antikörper (C-Term)

Produktnummer ABIN633952

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch FUT6 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für FUT6 Antikörper (C-Term) (ABIN633952)

Target: FUT6 (Fucosyltransferase 6 (Alpha (1,3) Fucosyltransferase) (FUT6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FUT6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-FUT6 Antikörper

Bindungsspezifität: C-Term

Spezifität: FUT6 antibody was raised against the C terminal of FUT6

Aufreinigung: Affinity purified

Immunogen: FUT6 antibody was raised using the C terminal of FUT6 corresponding to a region with amino acids YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FUT6 Blocking Peptide, (ABIN936108), is also available for use as a blocking control in assays to test for specificity of this FUT6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUT6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FUT6

Target: FUT6 (Fucosyltransferase 6 (Alpha (1,3) Fucosyltransferase) (FUT6))

Andere Bezeichnung: FUT6

Hintergrund: FUT6 is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.

Molekulargewicht: 42 kDa (MW of target protein)