AER61 Antikörper (C-Term)

Produktnummer ABIN633948

Produktdetails anti-AER61 Antikörper

Target: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AER61 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C3 ORF64 antibody was raised against the C terminal Of C3 rf64

Aufreinigung: Affinity purified

Immunogen: C3 ORF64 antibody was raised using the C terminal Of C3 rf64 corresponding to a region with amino acids GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C3ORF64 Blocking Peptide, catalog no. 33R-3308, is also available for use as a blocking control in assays to test for specificity of this C3ORF64 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF64 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AER61

Target: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Andere Bezeichnung: C3ORF64 (C3orf64 Produkte)

Synonyme: AER61 antikoerper, aer61 antikoerper, c3orf64 antikoerper, C12H3orf64 antikoerper, EOGT antikoerper, C22H3orf64 antikoerper, AOS4 antikoerper, C3orf64 antikoerper, EOGT1 antikoerper, A130022J15Rik antikoerper, AI447490 antikoerper, AW214473 antikoerper, AW259391 antikoerper, Aer61 antikoerper, EGF domain specific O-linked N-acetylglucosamine transferase antikoerper, glycosyltransferase aer61 antikoerper, EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase antikoerper, EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase L homeolog antikoerper, EOGT antikoerper, aer61 antikoerper, eogt antikoerper, eogt.L antikoerper, Eogt antikoerper

Hintergrund: The function of C3orf64 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 52 kDa (MW of target protein)