AER61 Antikörper (C-Term)

Produktnummer ABIN633948

Dieses Anti-AER61-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von AER61 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für AER61 Antikörper (C-Term) (ABIN633948)

Target: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AER61 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AER61 Antikörper

Bindungsspezifität: C-Term

Spezifität: C3 ORF64 antibody was raised against the C terminal Of C3 rf64

Aufreinigung: Affinity purified

Immunogen: C3 ORF64 antibody was raised using the C terminal Of C3 rf64 corresponding to a region with amino acids GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C3ORF64 Blocking Peptide, (ABIN938694), is also available for use as a blocking control in assays to test for specificity of this C3ORF64 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF64 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AER61

Target: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Andere Bezeichnung: C3ORF64

Hintergrund: The function of C3orf64 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 52 kDa (MW of target protein)