B3GALNT2 Antikörper (Middle Region)
-
- Target Alle B3GALNT2 Antikörper anzeigen
- B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser B3GALNT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- B3 GALNT2 antibody was raised against the middle region of B3 ALNT2
- Aufreinigung
- Affinity purified
- Immunogen
- B3 GALNT2 antibody was raised using the middle region of B3 ALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL
- Top Product
- Discover our top product B3GALNT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
B3GALNT2 Blocking Peptide, catalog no. 33R-7062, is also available for use as a blocking control in assays to test for specificity of this B3GALNT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))
- Andere Bezeichnung
- B3GALNT2 (B3GALNT2 Produkte)
- Synonyme
- B3GalNAc-T2 antikoerper, MDDGA11 antikoerper, RGD1306946 antikoerper, zgc:112351 antikoerper, A930105D20Rik antikoerper, C80633 antikoerper, D230016N13Rik antikoerper, beta-1,3-N-acetylgalactosaminyltransferase 2 antikoerper, beta-1,3-N-acetylgalactosaminyltransferase 2 L homeolog antikoerper, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2 antikoerper, B3GALNT2 antikoerper, b3galnt2 antikoerper, B3galnt2 antikoerper, b3galnt2.L antikoerper
- Hintergrund
- B3GALNT2 is the beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. B3GALNT2 has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.
- Molekulargewicht
- 57 kDa (MW of target protein)
-