B3GALNT2 Antikörper (Middle Region)

Produktnummer ABIN633947

Der Kaninchen Polyklonal anti-B3GALNT2 Antikörper wird verwendet zum Nachweis von B3GALNT2 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für B3GALNT2 Antikörper (Middle Region) (ABIN633947)

Target: B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser B3GALNT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-B3GALNT2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: B3 GALNT2 antibody was raised against the middle region of B3 ALNT2

Aufreinigung: Affinity purified

Immunogen: B3 GALNT2 antibody was raised using the middle region of B3 ALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

B3GALNT2 Blocking Peptide, (ABIN5612254), is also available for use as a blocking control in assays to test for specificity of this B3GALNT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu B3GALNT2

Target: B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))

Andere Bezeichnung: B3GALNT2

Hintergrund: B3GALNT2 is the beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. B3GALNT2 has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.

Molekulargewicht: 57 kDa (MW of target protein)