GALNT10 Antikörper (N-Term)

Produktnummer ABIN633943

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch GALNT10 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für GALNT10 Antikörper (N-Term) (ABIN633943)

Target: GALNT10 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GALNT10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GALNT10 Antikörper

Bindungsspezifität: N-Term

Spezifität: GALNT10 antibody was raised against the N terminal Of Galnt10

Aufreinigung: Affinity purified

Immunogen: GALNT10 antibody was raised using the N terminal Of Galnt10 corresponding to a region with amino acids VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GALNT10 Blocking Peptide, (ABIN5613716), is also available for use as a blocking control in assays to test for specificity of this GALNT10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GALNT10

Target: GALNT10 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10))

Andere Bezeichnung: GALNT10

Hintergrund: GALNT10 belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates.

Molekulargewicht: 31 kDa (MW of target protein)