LIPF Antikörper (N-Term)

Produktnummer ABIN633941

Produktdetails anti-LIPF Antikörper

Target: LIPF (Lipase, Gastric (LIPF))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LIPF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Lipase antibody (Gastric) was raised against the N terminal of LIPF

Aufreinigung: Affinity purified

Immunogen: Lipase antibody (Gastric) was raised using the N terminal of LIPF corresponding to a region with amino acids ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lipase Blocking Peptide (Gastric), catalog no. 33R-4163, is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Gastric)

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LIPF

Target: LIPF (Lipase, Gastric (LIPF))

Andere Bezeichnung: Gastric Lipase (LIPF Produkte)

Hintergrund: This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism.

Molekulargewicht: 43 kDa (MW of target protein)